PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_63743.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 293aa    MW: 32185.5 Da    PI: 9.219
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_63743.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.81.3e-50191431128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdeelv++yL+++++g ++++  +i+evd+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg dk+v s   
  MLOC_63743.1  19 LPPGFRFHPTDEELVMHYLCRRCAGLPISV-PIIAEVDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRSAGTGYWKATGADKPVGS--P 112
                   79****************************.88***************7666789*************************************99..7 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +   +kk Lvfy g+apkg kt+W+mheyrl
  MLOC_63743.1 113 KPLAIKKALVFYAGKAPKGDKTNWIMHEYRL 143
                   789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-6115169IPR003441NAC domain
PROSITE profilePS5100559.13519169IPR003441NAC domain
PfamPF023651.1E-2520143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSGGGGGSAA TQGQQDLQLP PGFRFHPTDE ELVMHYLCRR CAGLPISVPI IAEVDLYKFD  60
PWQLPRMALY GEKEWYFFSP RDRKYPNGSR PNRSAGTGYW KATGADKPVG SPKPLAIKKA  120
LVFYAGKAPK GDKTNWIMHE YRLADVDRSA RKKNSLRLDD WVLCRIYNKK GASERPSAGD  180
RAGKASPGHA AVGSPPEQKP ALLPPYAPPP FSDLAAYYEV RPSDSMPRAH ADSSCSEHVL  240
TASCERPEVQ SQPKISDWER TFASTAPGVN PAAGLPAGDP LLQDILMYWG KPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-7961752174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3769310.0AK376931.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3144G06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568425.11e-166PREDICTED: NAC domain-containing protein 48
RefseqNP_001136644.11e-166putative NAC domain transcription factor superfamily protein
SwissprotQ7F2L31e-155NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLM0XWR00.0M0XWR0_HORVD; Uncharacterized protein
STRINGMLOC_63743.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-114NAC family protein